PDB entry 2d8y

View 2d8y on RCSB PDB site
Description: Solution structure of the LIM domain of Epithelial protein lost in neoplasm
Class: Structural protein
Keywords: LIM domain, Epithelial protein lost in neoplasm, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EPLIN protein
    Species: HOMO SAPIENS
    Gene: EPLIN
    Database cross-references and differences (RAF-indexed):
    • GB AAH01247 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOP 1.73: d2d8ya1, d2d8ya2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8yA (A:)
    gssgssgmkfqaparetcvecqktvypmerllanqqvfhiscfrcsycnnklslgtyasl
    hgriyckphfnqlfkskgnydegfgsgpssg