PDB entry 2d8y

View 2d8y on RCSB PDB site
Description: Solution structure of the LIM domain of Epithelial protein lost in neoplasm
Class: Structural protein
Keywords: LIM domain, Epithelial protein lost in neoplasm, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EPLIN protein
    Species: Homo sapiens [TaxId:9606]
    Gene: EPLIN
    Database cross-references and differences (RAF-indexed):
    • GB AAH01247 (7-84)
      • cloning artifact (0-6)
      • cloning artifact (85-90)
    Domains in SCOPe 2.08: d2d8ya1, d2d8ya2, d2d8ya3, d2d8ya4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d8yA (A:)
gssgssgmkfqaparetcvecqktvypmerllanqqvfhiscfrcsycnnklslgtyasl
hgriyckphfnqlfkskgnydegfgsgpssg