PDB entry 2d8x

View 2d8x on RCSB PDB site
Description: Solution structure of the second LIM domain of particularly interesting new Cys-His protein (PINCH)
Class: Structural protein, Cell cycle
Keywords: LIM domain; PINCH protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein PINCH
  Species: HOMO SAPIENS
  Gene: LIMS1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P48059 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOP 1.75: d2d8xa1, d2d8xa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8xA (A:)
  gssgssgchqcgefiigrvikamnnswhpecfrcdlcqevladigfvknagrhlcrpchn
  rekasgpssg