PDB entry 2d8v

View 2d8v on RCSB PDB site
Description: Solution structure of the B-box domain of the zinc finger FYVE domain-containing protein 19 from Mus musculus
Class: metal binding protein
Keywords: Zinc finger FYVE domain-containing protein 19, Zfyve19, zf-B_box, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-08, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger FYVE domain-containing protein 19
  Species: MUS MUSCULUS
  Gene: Zfyve19
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9DAZ9 (7-60)
    • cloning artifact (0-6)
    • cloning artifact (61-66)
  Domains in SCOP 1.75: d2d8va1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8vA (A:)
  gssgssglpwccicnedatlrcagcdgdlycarcfreghdnfdlkehqtspyhprrpcqe
  hsgpssg