PDB entry 2d8v

View 2d8v on RCSB PDB site
Description: Solution structure of the B-box domain of the zinc finger FYVE domain-containing protein 19 from Mus musculus
Class: metal binding protein
Keywords: Zinc finger FYVE domain-containing protein 19, Zfyve19, zf-B_box, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger FYVE domain-containing protein 19
    Species: Mus musculus [TaxId:10090]
    Gene: Zfyve19
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9DAZ9 (7-60)
      • cloning artifact (0-6)
      • cloning artifact (61-66)
    Domains in SCOPe 2.08: d2d8va1, d2d8va2, d2d8va3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8vA (A:)
    gssgssglpwccicnedatlrcagcdgdlycarcfreghdnfdlkehqtspyhprrpcqe
    hsgpssg