PDB entry 2d8u

View 2d8u on RCSB PDB site
Description: Solution structure of the B-box domain of the human tripartite motif-containing 63 protein
Class: Ligase
Keywords: tripartite motif-containing 63, TRIM63, Muscle-specific RING finger protein 1, MuRF1, RING finger protein 28, Striated muscle RING zinc finger protein, Iris ring finger protein, zf-B_box, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Ligase
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin ligase TRIM63
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM63
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q969Q1 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.08: d2d8ua1, d2d8ua2, d2d8ua3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8uA (A:)
    gssgssghpmckehedekiniycltcevptcsmckvfgihkacevaplqsvfqgqktesg
    pssg