PDB entry 2d8r

View 2d8r on RCSB PDB site
Description: Solution structure of the thap domain of the human thap domain-containing protein 2
Class: metal binding protein
Keywords: THAP domain-containing protein 2,thap2,thap,structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THAP domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: thap2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H0W7 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOPe 2.08: d2d8ra1, d2d8ra2, d2d8ra3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8rA (A:)
    gssgssgmptncaaagcattynkhinisfhrfpldpkrrkewvrlvrrknfvpgkhtflc
    skhfeascfdltgqtrrlkmdavptifdfcthisgpssg