PDB entry 2d8q

View 2d8q on RCSB PDB site
Description: Solution structure of the MYND domain of the human zinc finger MYND domain-containing protein 10
Class: metal binding protein
Keywords: Zinc finger MYND domain containing protein 10, BLu protein, ZMYND10, zf-MYND, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-12-08, released 2006-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger MYND domain containing protein 10
  Species: Homo sapiens [TaxId:9606]
  Gene: ZMYND10
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75800 (7-63)
    • cloning artifact (0-6)
    • cloning artifact (64-69)
  Domains in SCOPe 2.08: d2d8qa1, d2d8qa2, d2d8qa3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8qA (A:)
  gssgssgleavaperprcaycsaeaskrcsrcqnewyccrecqvkhwekhgktcvlaaqg
  draksgpssg