PDB entry 2d8p

View 2d8p on RCSB PDB site
Description: Structure of HYPER-VIL-thaumatin
Class: unknown function
Keywords: iodo-tyrosine, HYDROGEN PEROXIDE VAPORIZING IODINE LABELING(HYPER-VIL), UNKNOWN FUNCTION
Deposited on 2005-12-08, released 2006-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02883 (0-206)
      • modified residue (10)
      • modified residue (56)
      • modified residue (94)
      • modified residue (98)
      • modified residue (168)
    Domains in SCOPe 2.08: d2d8pa_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8pA (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta