PDB entry 2d8n

View 2d8n on RCSB PDB site
Description: Crystal structure of human recoverin at 2.2 A resolution
Class: metal binding protein
Keywords: Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-12-07, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recoverin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35243 (7-End)
      • modified residue (7)
      • modified residue (98)
      • modified residue (133)
      • modified residue (138)
      • modified residue (203)
    Domains in SCOPe 2.08: d2d8na_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d8nA (A:)
    gssgssgmgnsksgalskeileelqlntkfseeelcswyqsflkdcptgritqqqfqsiy
    akffpdtdpkayaqhvfrsfdsnldgtldfkeyvialhmttagktnqklewafslydvdg
    ngtisknevleivmaifkmitpedvkllpddentpekraekiwkyfgkndddkltekefi
    egtlankeilrliqfepqkvkekmkna
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d8nA (A:)
    mgnsksgalskeileelqlntkfseeelcswyqsflkdcptgritqqqfqsiyakffpdt
    dpkayaqhvfrsfdsnldgtldfkeyvialhmttagktnqklewafslydvdgngtiskn
    evleivmaifkmitpedvkllpddentpekraekiwkyfgkndddkltekefiegtlank
    eilrliqfepqkvkekm