PDB entry 2d8k

View 2d8k on RCSB PDB site
Description: Solution structure of the first C2 domain of synaptotagmin VII
Class: endocytosis/exocytosis
Keywords: exocytosis, calcium binding, lysosome, C2 domain, synaptotagmin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2005-12-06, released 2006-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synaptotagmin VII
    Species: Homo sapiens [TaxId:9606]
    Gene: SYT7
    Database cross-references and differences (RAF-indexed):
    • GB NP_004191 (7-134)
      • cloning artifact (0-6)
      • cloning artifact (135-140)
    Domains in SCOPe 2.07: d2d8ka1, d2d8ka2, d2d8ka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8kA (A:)
    gssgssgsrenlgriqfsvgynfqestltvkimkaqelpakdfsgtsdpfvkiyllpdkk
    hkletkvkrknlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnk
    vdltqmqtfwkdlkpsgpssg