PDB entry 2d8j

View 2d8j on RCSB PDB site
Description: Solution structure of the SH3 domain of Fyn-related kinase
Class: transferase
Keywords: SH3 domain, Fyn-related kinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-12-06, released 2006-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fyn-related kinase
    Species: Mus musculus [TaxId:10090]
    Gene: FrK
    Database cross-references and differences (RAF-indexed):
    • GB NP_034367 (7-70)
      • cloning artifact (0-6)
      • cloning artifact (71-76)
    Domains in SCOPe 2.08: d2d8ja1, d2d8ja2, d2d8ja3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8jA (A:)
    gssgssgqyfvalfdyqartaedlsfragdklqvldtshegwwlarhlekkgtglgqqlq
    gyipsnyvaedsgpssg