PDB entry 2d8h

View 2d8h on RCSB PDB site
Description: Solution structure of the SH3 domain of Hypothetical protein SH3YL1
Class: unknown function
Keywords: SH3 domain, Hypothetical protein SH3YL1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-12-06, released 2006-06-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SH3YL1 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: SH3YL1
  Database cross-references and differences (RAF-indexed):
  • GB AAH08374 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.06: d2d8ha1, d2d8ha2, d2d8ha3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8hA (A:)
  gssgssghervgnlnqpievtalysfegqqpgdlnfqagdritvisktdshfdwwegklr
  gqtgifpanyvtmnsgpssg