PDB entry 2d8e

View 2d8e on RCSB PDB site
Description: Structure of Chorismate Mutase (Form II) from Thermus Thermophilus HB8
Class: isomerase
Keywords: Chorismate Mutase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.225
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: AROAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d8ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d8eA (A:)
    mderiqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltae
    npgpfpdetirklfkeifkasldleerqdq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d8eA (A:)
    eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
    gpfpdetirklfkeifkasldleerqdq