PDB entry 2d8e

View 2d8e on RCSB PDB site
Description: Structure of Chorismate Mutase (Form II) from Thermus Thermophilus HB8
Class: isomerase
Keywords: Chorismate Mutase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ISOMERASE
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.225
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospho-2-dehydro-3-deoxyheptonate aldolase/chorismate mutase
  Species: Thermus thermophilus [TaxId:300852]
  Gene: AROAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72LN8 (Start-89)
  Domains in SCOPe 2.08: d2d8ea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2d8eA (A:)
  mderiqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltae
  npgpfpdetirklfkeifkasldleerqdq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2d8eA (A:)
  eriqalrkevdrvnreilrllsergrlvqeigrlqtelglphydpkreeemlayltaenp
  gpfpdetirklfkeifkasldleerqdq