PDB entry 2d8c

View 2d8c on RCSB PDB site
Description: Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
Class: transferase
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, LIPID METABOLISM, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-02, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phosphatidylcholine:ceramide cholinephosphotransferase 1
  Species: MUS MUSCULUS
  Gene: 9530058O11Rik
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8VCQ6 (7-90)
    • cloning artifact (0-6)
    • cloning artifact (91-96)
  Domains in SCOP 1.75: d2d8ca1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d8cA (A:)
  gssgssgmlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkp
  plyrvssdngqrlldmietlkmehhmeahknsgpssg