PDB entry 2d8c

View 2d8c on RCSB PDB site
Description: Solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
Class: transferase
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, LIPID METABOLISM, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylcholine:ceramide cholinephosphotransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: 9530058O11Rik
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCQ6 (7-90)
      • cloning artifact (0-6)
      • cloning artifact (91-96)
    Domains in SCOPe 2.08: d2d8ca1, d2d8ca2, d2d8ca3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d8cA (A:)
    gssgssgmlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkp
    plyrvssdngqrlldmietlkmehhmeahknsgpssg