PDB entry 2d87

View 2d87 on RCSB PDB site
Description: Solution structure of the CH domain from human Smoothelin splice isoform L2
Class: structural protein, protein binding
Keywords: all alpha, calponin homology domain, actin binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Smoothelin splice isoform L2
    Species: Homo sapiens [TaxId:9606]
    Gene: SMTN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53814 (7-121)
      • cloning artifact (0-6)
      • cloning artifact (122-127)
    Domains in SCOPe 2.08: d2d87a1, d2d87a2, d2d87a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d87A (A:)
    gssgssgikqmlldwcraktrgyehvdiqnfssswsdgmafcalvhnffpeafdygqlsp
    qnrrqnfevafssaethadcpqlldtedmvrlrepdwkcvytyiqefyrclvqkglvktk
    kssgpssg