PDB entry 2d85

View 2d85 on RCSB PDB site
Description: Solution structure of the fourth CH domain from human L-plastin
Class: structural protein, protein binding
Keywords: all alpha, calponin homology domain, actin binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN, PROTEIN BINDING
Deposited on 2005-12-02, released 2006-06-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: L-plastin
  Species: Homo sapiens [TaxId:9606]
  Gene: LCP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13796 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOPe 2.08: d2d85a1, d2d85a2, d2d85a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d85A (A:)
  gssgssgnddiivnwvnetlreaeksssissfkdpkistslpvldlidaiqpgsinydll
  ktenlnddeklnnakyaismarkigarvyalpedlvevnpkmvmtvfaclmgkgmkrvsg
  pssg