PDB entry 2d7z

View 2d7z on RCSB PDB site
Description: Aspartate Aminotransferase Mutant MAB Complexed with Maleic Acid
Class: transferase
Keywords: aspartate aminotransferase, direct evolution, protein design, protein enginnering, TRANSFERASE
Deposited on 2005-11-30, released 2006-11-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.172
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: aspC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00509 (0-395)
      • engineered (6)
      • engineered (19)
      • engineered (29)
      • engineered (32)
      • engineered (36)
      • engineered (128)
      • engineered (131)
      • engineered (280)
      • engineered (284)
    Domains in SCOPe 2.07: d2d7za_
  • Heterogens: PLP, MAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7zA (A:)
    mfenittapadpilgladllraderpgkidlgmgvyndetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpgwpthksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairvnyssppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl