PDB entry 2d7v

View 2d7v on RCSB PDB site
Description: Structure of OsmC-like Protein of Unknown Function VCA0330 from Vibrio cholerae O1 biovar eltor str. N16961
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, Vibrio cholerae, hypothetial protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-11-30, released 2006-01-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.202
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein VCA0330
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VCA0330
    Database cross-references and differences (RAF-indexed):
    • GB AAF96238
      • modified residue (7)
      • modified residue (77)
      • modified residue (137)
    Domains in SCOPe 2.08: d2d7va1
  • Chain 'B':
    Compound: Hypothetical protein VCA0330
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VCA0330
    Database cross-references and differences (RAF-indexed):
    • GB AAF96238
      • modified residue (7)
      • modified residue (77)
      • modified residue (137)
    Domains in SCOPe 2.08: d2d7vb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d7vA (A:)
    msfggksmsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsve
    anvdpeeafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrp
    qvvfsgtskptlqqlekmhhlahencfiansvetevvteiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d7vA (A:)
    smsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpe
    eafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsg
    tskptlqqlekmhhlahencfiansvetevvteii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d7vB (B:)
    msfggksmsehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsve
    anvdpeeafvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrp
    qvvfsgtskptlqqlekmhhlahencfiansvetevvteiia
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d7vB (B:)
    msehsaivtwkrkdseaftdnqysrahtwefdggskilasasphvvpvplsveanvdpee
    afvaalsschmlvflsiaakqrylvesytdnavgilgknskgktsvtkvvlrpqvvfsgt
    skptlqqlekmhhlahencfiansvetevvteii