PDB entry 2d7t

View 2d7t on RCSB PDB site
Description: Crystal structure of human anti polyhydroxybutyrate antibody Fv
Class: immune system
Keywords: antibody, plastic, polyhydroxybutyrate, IMMUNE SYSTEM
Deposited on 2005-11-29, released 2006-12-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anti polyhydroxybutyrate antibody Fv, heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d7th_
  • Chain 'L':
    Compound: anti polyhydroxybutyrate antibody Fv, light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2d7tl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2d7tH (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftgnymhwvrqapgqgleymgwinpksgdtny
    aqkfqgrvtmtrdtsistvymevrrlrsddtavyycatgwwgmdvwgqgtlvtvssaseq
    kliskedlngsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d7tH (H:)
    qvqlvqsgaevkkpgasvkvsckasgytftgnymhwvrqapgqgleymgwinpksgdtny
    aqkfqgrvtmtrdtsistvymevrrlrsddtavyycatgwwgmdvwgqgtlvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2d7tL (L:)
    divmtqspsslsasvgdrvtitcrasqninnylhwyqhepgkapklliyaasnlqggvts
    rfsgsgsgtdftltistlqpedfatyyclqthaypltfgggtkvdikraahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d7tL (L:)
    divmtqspsslsasvgdrvtitcrasqninnylhwyqhepgkapklliyaasnlqggvts
    rfsgsgsgtdftltistlqpedfatyyclqthaypltfgggtkvdikraa