PDB entry 2d7p

View 2d7p on RCSB PDB site
Description: Solution structure of the 22th Filamin domain from human Filamin C
Class: structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-11-24, released 2006-05-24
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-24, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-C
  Species: HOMO SAPIENS
  Gene: FLNC
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14315 (7-105)
    • cloning artifact (0-6)
    • cloning artifact (106-111)
  Domains in SCOP 1.73: d2d7pa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d7pA (A:)
  gssgssgsddarrltvtslqetglkvnqpasfavqlngargvidarvhtpsgaveecyvs
  eldsdkhtirfiphengvhsidvkfngahipgspfkirvgeqsqagsgpssg