PDB entry 2d7l

View 2d7l on RCSB PDB site
Description: Solution structure of the HMG box domain from human WD repeat and HMG-box DNA binding protein 1
Class: gene regulation, DNA binding protein
Keywords: high mobility group box domain, helix-turn-helix, DNA binding, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION, DNA BINDING PROTEIN
Deposited on 2005-11-24, released 2006-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: WD repeat and HMG-box DNA binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: WDHD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75717 (7-74)
    • cloning artifact (0-6)
    • cloning artifact (75-80)
  Domains in SCOPe 2.08: d2d7la1, d2d7la2, d2d7la3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d7lA (A:)
  gssgssgrpktgfqmwleenrsnilsdnpdfsdeadiikegmirfrvlsteerkvwanka
  kgetasegteakkrksgpssg