PDB entry 2d74

View 2d74 on RCSB PDB site
Description: Crystal structure of translation initiation factor aIF2betagamma heterodimer
Class: translation
Keywords: protein complex, translation
Deposited on 2005-11-16, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1717
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U082 (Start-410)
      • engineered (235)
      • expression tag (411)
  • Chain 'B':
    Compound: Translation initiation factor 2 beta subunit
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF0481
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d74b1, d2d74b2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d74B (B:)
    meidyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdp
    qhllkfllreiatagtlegrrvvlqgrftpylianklkkyikeyvicpvcgspdtkiikr
    drfhflkceacgaetpiqhllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d74B (B:)
    idyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdpqh
    llkfllreiatagtlegrrvvlqgrftpylianklkkyikeyvicpvcgspdtkiikrdr
    fhflkceacgaetpiqh