PDB entry 2d74

View 2d74 on RCSB PDB site
Description: Crystal structure of translation initiation factor aIF2betagamma heterodimer
Class: translation
Keywords: protein complex, translation
Deposited on 2005-11-16, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Translation initiation factor 2 gamma subunit
  Species: Pyrococcus furiosus [TaxId:186497]
  Gene: PF1717
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U082 (Start-410)
    • engineered (235)
    • expression tag (411)
• Chain 'B':
  Compound: Translation initiation factor 2 beta subunit
  Species: Pyrococcus furiosus [TaxId:186497]
  Gene: PF0481
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8U3I5
  Domains in SCOPe 2.08: d2d74b1, d2d74b2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2d74B (B:)
  meidyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdp
  qhllkfllreiatagtlegrrvvlqgrftpylianklkkyikeyvicpvcgspdtkiikr
  drfhflkceacgaetpiqhllehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2d74B (B:)
  idyydyekllekayqelpenvkhhksrfevpgalvtiegnktiienfkdiadalnrdpqh
  llkfllreiatagtlegrrvvlqgrftpylianklkkyikeyvicpvcgspdtkiikrdr
  fhflkceacgaetpiqh