PDB entry 2d6y

View 2d6y on RCSB PDB site
Description: Crystal Structure of transcriptional factor SCO4008 from Streptomyces coelicolor A3(2)
Class: gene regulation
Keywords: Helix-turn-Helix
Deposited on 2005-11-15, released 2006-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.207
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative tetR family regulatory protein
    Species: Streptomyces Coelicolor
    Gene: SCO4008
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ADP7 (Start-191)
      • modified residue (63)
      • modified residue (103)
      • modified residue (152)
      • modified residue (162)
    Domains in SCOP 1.73: d2d6ya1, d2d6ya2
  • Chain 'B':
    Compound: putative tetR family regulatory protein
    Species: Streptomyces Coelicolor
    Gene: SCO4008
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ADP7 (Start-191)
      • modified residue (63)
      • modified residue (103)
      • modified residue (152)
      • modified residue (162)
    Domains in SCOP 1.73: d2d6yb1, d2d6yb2
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d6yA (A:)
    maardpeatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvl
    ekkmldlaisvpvdpddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqeh
    yarkvaavrdgqergvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrd
    sikkaarrivdrrslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6yA (A:)
    eatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvlekkmld
    laisvpvdpddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqehyarkva
    avrdgqergvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrdsikkaa
    rrivdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d6yB (B:)
    maardpeatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvl
    ekkmldlaisvpvdpddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqeh
    yarkvaavrdgqergvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrd
    sikkaarrivdrrslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6yB (B:)
    dpeatkarifeaavaefarhgiagaridriaaearankqliyayygnkgelfasvlekkm
    ldlaisvpvdpddiegwidrlldyhaahpellrllfwegmeygtaelpheaerqehyark
    vaavrdgqergvitdaipapdllfllvamanwavvvpqmkrilvgggdagtdglrdsikk
    aarrivdr