PDB entry 2d6p

View 2d6p on RCSB PDB site
Description: Crystal structure of mouse galectin-9 N-terminal CRD in complex with T-antigen
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, SUGAR BINDING PROTEIN
Deposited on 2005-11-14, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d6pa_
  • Chain 'B':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d6pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d6pA (A:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6pA (A:)
    alfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqgndiafhfnprf
    eeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqyqhrv
    pyhlvdtiavsgclklsfitfqtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d6pB (B:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6pB (B:)
    lfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndiafhfn
    prfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkffvqyq
    hrvpyhlvdtiavsgclklsfitfqtq