PDB entry 2d6m

View 2d6m on RCSB PDB site
Description: Crystal structure of mouse galectin-9 N-terminal CRD in complex with lactose
Class: sugar binding protein
Keywords: beta sandwich, carbohydrate binding protein, galectin, SUGAR BINDING PROTEIN
Deposited on 2005-11-14, released 2006-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-13, with a file datestamp of 2009-10-09.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99L83 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2d6ma1, d2d6ma2
  • Chain 'B':
    Compound: lectin, galactose binding, soluble 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99L83 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d2d6mb1, d2d6mb2
  • Heterogens: LBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d6mA (A:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6mA (A:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d6mB (B:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtqnfrpahqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6mB (B:)
    gsmalfsaqspyinpiipftgpiqgglqeglqvtlqgttksfaqrfvvnfqnsfngndia
    fhfnprfeeggyvvcntkqngqwgpeerkmqmpfqkgmpfelcflvqrsefkvmvnkkff
    vqyqhrvpyhlvdtiavsgclklsfitfqtq