PDB entry 2d5x

View 2d5x on RCSB PDB site
Description: Crystal structure of carbonmonoxy horse hemoglobin complexed with L35
Class: oxygen storage/transport
Keywords: hemoglobin, l35, allosteric effector, crystal structure, oxygen storage/transport complex
Deposited on 2005-11-08, released 2006-03-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.192
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha subunit
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d5xa_
  • Chain 'B':
    Compound: Hemoglobin beta subunit
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2d5xb_
  • Heterogens: HEM, CMO, L35, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d5xA (A:)
vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
kvgdaltlavghlddlpgalsnlsdlhahklrvdpvnfkllshcllstlavhlpndftpa
vhasldkflssvstvltskyr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d5xB (B:)
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh