PDB entry 2d5u

View 2d5u on RCSB PDB site
Description: Solution structure of the N-terminal portion of the PUB domain of mouse peptide:N-glycanase
Class: hydrolase
Keywords: PNGase
Deposited on 2005-11-06, released 2006-11-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycanase 1
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • GB NP_067479 (5-123)
      • cloning artifact (0-4)
    Domains in SCOP 1.73: d2d5ua1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5uA (A:)
    gplgsmasatlgsssssaspavaelcqntpetfleaskllltyadnilrnpsdekyrsir
    igntafstrllpvrgaveclfemgfeegethlifpkkasveqlqkirdliaierssrldg
    sskk