PDB entry 2d5j

View 2d5j on RCSB PDB site
Description: Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond
Class: hydrolase
Keywords: alpha/alpha barrel, unsaturated glucuronyl hydrolase, HYDROLASE
Deposited on 2005-11-02, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d5ja_
  • Chain 'B':
    Compound: unsaturated glucuronyl hydrolase
    Species: Bacillus sp. [TaxId:84635]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d5jb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5jA (A:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5jB (B:)
    mwqqaigdalgitarnlkkfgdrfphvsdgsnkyvlndntdwtdgfwsgilwlcyeytgd
    eqyregavrtvasfrerldrfenldhhdigflyslsakaqwivekdesarklaldaadvl
    mrrwradagiiqawgpkgdpenggriiidcllnlplllwageqtgdpeyrrvaeahalks
    rrflvrgddssyhtfyfdpengnairggthqgntdgstwtrgqawgiygfalnsrylgna
    dlletakrmarhflarvpedgvvywdfevpqepssyrdssasaitacglleiasqldesd
    perqrfidaakttvtalrdgyaerddgeaegfirrgsyhvrggispddytiwgdyyylea
    llrlergvtgywyergr