PDB entry 2d5i

View 2d5i on RCSB PDB site
Description: The crystal structure of AzoR (Azo Reductase) from Escherichia coli
Class: oxidoreductase
Keywords: azo reductase, OXIDOREDUCTASE
Deposited on 2005-11-02, released 2006-05-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azo Reductase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2d5ia_
  • Heterogens: FMN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2d5iA (A:)
skvlvlkssilagysqsnqlsdyfveqwrekhsadeitvrdlaanpipvldgelvgalrp
sdapltprqqealalsdeliaelkahdviviaapmynfnistqlknyfdlvaragvtfry
tengpeglvtgkkaivitsrggihkdgptdlvtpylstflgfigitdvkfvfaegiaygp
emaakaqsdakaaidsivsa