PDB entry 2d5b

View 2d5b on RCSB PDB site
Description: Crystal Structure of Thermus Thermophilus Methionyl tRNA synthetase Y225F Mutant obtained in the presence of PEG6000
Class: isomerase
Keywords: Rossmann fold, class 1a aars, ISOMERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-10-31, released 2006-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23395 (0-499)
      • engineered (224)
    Domains in SCOPe 2.06: d2d5ba1, d2d5ba2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d5bA (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkk