PDB entry 2d5a

View 2d5a on RCSB PDB site
Description: hypothetical protein from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: coa binding, hypothetical protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-10-31, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.225
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1109
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: ph1109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d5aa_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d5aA (A:)
    meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
    evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
    deagliivanrcmmreherllgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d5aA (A:)
    meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
    evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
    deagliivanrcmmreherllg