PDB entry 2d59

View 2d59 on RCSB PDB site
Description: hypothetical protein from Pyrococcus horikoshii OT3
Class: structural genomics, unknown function
Keywords: coa binding, hypothetical protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-10-31, released 2006-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.212
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PH1109
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: ph1109
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d59a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d59A (A:)
    meetrpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkye
    evlgrkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskka
    deagliivanrcmmreherllgek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d59A (A:)
    trpidgltdedireiltrykkialvgaspkperdanivmkyllehgydvypvnpkyeevl
    grkcypsvldipdkievvdlfvkpkltmeyveqaikkgakvvwfqyntynreaskkadea
    gliivanrcmmreherllgek