PDB entry 2d54

View 2d54 on RCSB PDB site
Description: Crystal Structure of Methionyl tRNA Synthetase Y225A Mutant from Thermus Thermophilus
Class: isomerase
Keywords: Rossmann fold, class 1a aars, ISOMERASE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-10-28, released 2006-12-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.208
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23395 (0-End)
      • engineered (224)
    Domains in SCOPe 2.08: d2d54a1, d2d54a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d54A (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtavwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkkea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d54A (A:)
    mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
    qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
    eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
    irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtavwfdallnyvsaldy
    pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
    tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryeadladdlgnlvqrt
    ramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeamayvkalnryine
    kkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralglkeevrleeaer
    wglaeprpipeeapvlfpkk