PDB entry 2d4u

View 2d4u on RCSB PDB site
Description: Crystal Structure of the ligand binding domain of the bacterial serine chemoreceptor Tsr
Class: signaling protein
Keywords: helix-turn-helix, SIGNALING PROTEIN
Deposited on 2005-10-24, released 2006-11-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methyl-accepting chemotaxis protein I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02942 (4-End)
      • linker (0-3)
      • engineered (15)
    Domains in SCOPe 2.06: d2d4ua1, d2d4ua2
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein I
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02942
      • engineered (15)
    Domains in SCOPe 2.06: d2d4ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4uA (A:)
    gplgsgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
    igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
    qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnnasyshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4uA (A:)
    gplgsgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
    igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
    qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4uB (B:)
    gplgsgglffnalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnn
    igsgstvaelmesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeli
    qllgagkineffdqptqgyqdgfekqyvaymeqndrlhdiavsdnnasyshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4uB (B:)
    nalknckenftvlqtirqqqstlngswvallqtrntlnragirymmdqnnigsgstvael
    mesasislkqaeknwadyealprdprqstaaaaeikrnydiyhnalaeliqllgagkine
    ffdqptqgyqdgfekqyvaymeqndrlhdiavsdn