PDB entry 2d4p

View 2d4p on RCSB PDB site
Description: Crystal structure of TTHA1254 (wild type) from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2005-10-21, released 2006-04-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein TTHA1254
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q72J89 (0-End)
  Domains in SCOPe 2.03: d2d4pa1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2d4pA (A:)
  mrfrpfteedldrlnrlagkrpvslgalrffartghsflaeegeepmgfalaqavwqgea
  ttvlvtriegrsvealrgllravvksaydagvyevalhldperkeleealkaegfalgpl
  vlavrvlgsrgargetrgvle
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2d4pA (A:)
  mrfrpfteedldrlnrlagkrpvslgalrffartghsflaeegeepmgfalaqavwqgea
  ttvlvtriegrsvealrgllravvksaydagvyevalhldperkeleealkaegfalgpl
  vlavrvlgsr