PDB entry 2d4n

View 2d4n on RCSB PDB site
Description: Crystal Structure of M-PMV dUTPase complexed with dUPNPP, substrate analogue
Class: hydrolase
Keywords: jelly roll, HYDROLASE
Deposited on 2005-10-20, released 2006-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: du
    Species: Mason-Pfizer monkey virus [TaxId:11855]
    Gene: gag-pro
    Database cross-references and differences (RAF-indexed):
    • GB NP_954564
    Domains in SCOPe 2.07: d2d4na_
  • Heterogens: MG, DUP, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4nA (A:)
    krvegpapgpetslwgsqlcssqqkqpiskltratpgsagldlcstshtvltpemgpqal
    stgiygplppntfglilgrssitmkglqvypgvidndytgeikimakavnnivtvsqgnr
    iaqlillplietdnkvqqpyrgqgsfgssdiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4nA (A:)
    kqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssitm
    kglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq