PDB entry 2d4c

View 2d4c on RCSB PDB site
Description: Crystal structure of the endophilin BAR domain mutant
Class: transferase
Keywords: BAR domain
Deposited on 2005-10-13, released 2006-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-containing grb2-like protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (Start-255)
      • insertion (159-162)
    Domains in SCOP 1.73: d2d4ca1
  • Chain 'B':
    Compound: sh3-containing grb2-like protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (Start-255)
      • insertion (159-162)
    Domains in SCOP 1.73: d2d4cb1
  • Chain 'C':
    Compound: sh3-containing grb2-like protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (Start-255)
      • insertion (159-162)
    Domains in SCOP 1.73: d2d4cc1
  • Chain 'D':
    Compound: sh3-containing grb2-like protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99962 (Start-255)
      • insertion (159-162)
    Domains in SCOP 1.73: d2d4cd1
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4cA (A:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylqpnpasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalg
    evgeamrelsevkdsldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdyk
    kkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
    ilqqvtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4cA (A:)
    hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklyp
    qaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnlh
    dkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessmfn
    llemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4cB (B:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylqpnpasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalg
    evgeamrelsevkdsldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdyk
    kkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
    ilqqvtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4cB (B:)
    qfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasrakl
    smipgypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfi
    dplqnlhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskei
    aessmfnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d4cC (C:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylqpnpasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalg
    evgeamrelsevkdsldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdyk
    kkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
    ilqqvtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4cC (C:)
    hkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklpg
    ypqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqn
    lhdkdlreiqsalqhhlkklegrrldfdykkkrqgkipdeelrqalekfdeskeiaessm
    fnllemdieqvsqlsalvqaqleyhkqavqilqqvtvrleerirqa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d4cD (D:)
    gplgsmsvaglkkqfhkatqkvsekvggaegtkldddfkemerkvdvtsravmeimtkti
    eylqpnpasraklsmintmskirgqekgpgypqaeallaeamlkfgrelgddcnfgpalg
    evgeamrelsevkdsldievkqnfidplqnlhdkdlreiqsalqhhlkklegrrldfdyk
    kkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaqleyhkqavq
    ilqqvtvrleerirqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4cD (D:)
    katqkvsekvggaegtkldddfkemerkvdvtsravmeimtktieylqpnpasraklsmy
    pqaeallaeamlkfgrelgddcnfgpalgevgeamrelsevkdsldievkqnfidplqnl
    hdkdlreiqsalqhhlkklegrrldfdipdeelrqalekfdeskeiaessmfnllemdie
    qvsqlsalvqaqleyhkqavqilqqvtvrleerirqa