PDB entry 2d4a

View 2d4a on RCSB PDB site
Description: Structure of the malate dehydrogenase from Aeropyrum pernix
Class: oxidoreductase
Keywords: malate dehydrogenase, archaea, hyperthermophile, OXIDOREDUCTASE
Deposited on 2005-10-12, released 2006-11-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.205
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEA1 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2d4aa1, d2d4aa2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEA1 (1-307)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2d4ab1, d2d4ab2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEA1 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2d4ac1, d2d4ac2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Aeropyrum pernix [TaxId:56636]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YEA1 (1-307)
      • initiating methionine (0)
    Domains in SCOPe 2.05: d2d4ad1, d2d4ad2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d4aA (A:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
    amtyvmykktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvp
    rlssvggvplehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrds
    kriypyslylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklve
    tlppqlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4aA (A:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagiglleanantmadlaekikayakdaivvittnpvdamtyvmykk
    tgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggvp
    lehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrdskriypysly
    lqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklvetlppqlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d4aB (B:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
    amtyvmykktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvp
    rlssvggvplehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrds
    kriypyslylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklve
    tlppqlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4aB (B:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigeqlleanantmadlaekikayakdaivvittnpvdamtyvmy
    kktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvgg
    vplehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrdskriypys
    lylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklvetlppqlr
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d4aC (C:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
    amtyvmykktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvp
    rlssvggvplehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrds
    kriypyslylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklve
    tlppqlre
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d4aC (C:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigrkleanantmadlaekikayakdaivvittnpvdamtyvmyk
    ktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvprlssvggv
    plehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrdskriypysl
    ylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklvetlppqlr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d4aD (D:)
    mitilgagkvgmatavmlmmrgyddllliartpgkpqgealdlahaaaelgvdirisgsn
    syedmrgsdivlvtagigrkpgmtreqlleanantmadlaekikayakdaivvittnpvd
    amtyvmykktgfprervigfsgildsarmayyisqklgvsfksvnaivlgmhgqkmfpvp
    rlssvggvplehlmskeeieevvsetvnagakitelrgyssnygpaaglvltveaikrds
    kriypyslylqgeygyndivaevpavigksgieriielpltedekrkfdeavqavkklve
    tlppqlre