PDB entry 2d48

View 2d48 on RCSB PDB site
Description: Crystal structure of the Interleukin-4 variant T13D
Class: cytokine
Keywords: four helix bundle, CYTOKINE
Deposited on 2005-10-11, released 2006-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.222
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05112 (0-128)
    • engineered (12)
  Domains in SCOPe 2.07: d2d48a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2d48A (A:)
  hkcditlqeiikdlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
  kdtrclgataqqfhrhkqlirflkrldrnlwglaglnscpvkeanqstlenflerlktim
  rekyskcss