PDB entry 2d44

View 2d44 on RCSB PDB site
Description: Crystal structure of arabinofuranosidase complexed with arabinofuranosyl-alpha-1,2-xylobiose
Class: hydrolase
Keywords: arabinofuranosyl-alpha-1,2-xylobiose complex
Deposited on 2005-10-07, released 2006-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-L-arabinofuranosidase B
    Species: Aspergillus kawachii
    Database cross-references and differences (RAF-indexed):
    • GB BAB96816 (1-481)
      • initiating methionine (0)
      • engineered (203)
    Domains in SCOP 1.73: d2d44a1, d2d44a2
  • Heterogens: AHR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d44A (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    as