PDB entry 2d43

View 2d43 on RCSB PDB site
Description: Crystal structure of arabinofuranosidase complexed with arabinotriose
Class: hydrolase
Keywords: arabinotriose complex, HYDROLASE
Deposited on 2005-10-07, released 2006-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-L-arabinofuranosidase B
    Species: Aspergillus kawachii [TaxId:40384]
    Database cross-references and differences (RAF-indexed):
    • GB BAB96816 (1-481)
      • initiating methionine (0)
      • engineered (203)
    Domains in SCOPe 2.06: d2d43a1, d2d43a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d43A (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmannlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    as