PDB entry 2d3w

View 2d3w on RCSB PDB site
Description: Crystal Structure of Escherichia coli SufC, an ATPase compenent of the SUF iron-sulfur cluster assembly machinery
Class: biosynthetic protein
Keywords: ABC-ATPase, ABC-transporter, Crystal structure, Iron-sulfur cluster, SufC, BIOSYNTHETIC PROTEIN
Deposited on 2005-10-03, released 2006-01-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d3wa_
  • Chain 'B':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d3wb_
  • Chain 'C':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d3wc_
  • Chain 'D':
    Compound: Probable ATP-dependent transporter sufC
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2d3wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3wA (A:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3wA (A:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d3wB (B:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3wB (B:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsldidal
    kvvadgvnslrdgkrsfiivthyrildyikpdyvhvlyqgrivksgdftlvkqleeqgyg
    wlte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d3wC (C:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3wC (C:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesddidalkv
    vadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqgygw
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d3wD (D:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdsgldida
    lkvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqg
    ygwlteqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3wD (D:)
    mlsikdlhvsvedkailrglsldvhpgevhaimgpngsgkstlsatlagredyevtggtv
    efkgkdllalspedragegifmafqypveipgvsnqfflqtalnavrsyrgqetldrfdf
    qdlmeekiallkmpedlltrsvnvgfsggekkrndilqmavlepelcildesdgldidal
    kvvadgvnslrdgkrsfiivthyqrildyikpdyvhvlyqgrivksgdftlvkqleeqgy
    gwl