PDB entry 2d3s

View 2d3s on RCSB PDB site
Description: Crystal Structure of basic winged bean lectin with Tn-antigen
Class: sugar binding protein
Keywords: Legume lectin, GLYCOSYLATED PROTEIN, AGGLUTININ, TN-ANTIGEN
Deposited on 2005-10-01, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.198
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d3sa1
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d3sb1
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d3sc1
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d3sd1
  • Heterogens: NAG, CA, MN, TNR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3sA (A:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3sA (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d3sB (B:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3sB (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d3sC (C:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3sC (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d3sD (D:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3sD (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg