PDB entry 2d3q

View 2d3q on RCSB PDB site
Description: Crystal Structure of a Decolorizing Peroxidase (DyP) That Catalyses the Biological Oxidation of Anthraquinone Derivatives
Class: oxidoreductase
Keywords: strands and helix, OXIDOREDUCTASE
Deposited on 2005-09-30, released 2006-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-10-26, with a file datestamp of 2011-10-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.234
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Decolorizing Peroxidase
    Species: Bjerkandera adusta [TaxId:5331]
    Database cross-references and differences (RAF-indexed):
    • GB BAA77283 (Start-441)
    Domains in SCOPe 2.06: d2d3qa1
  • Chain 'B':
    Compound: Decolorizing Peroxidase
    Species: Bjerkandera adusta [TaxId:5331]
    Database cross-references and differences (RAF-indexed):
    • GB BAA77283 (Start-441)
    Domains in SCOPe 2.06: d2d3qb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3qA (A:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3qA (A:)
    tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
    lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
    gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
    tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
    agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
    pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
    gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
    ggeyfflpsisaltatiaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d3qB (B:)
    andtilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdps
    qqplafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgv
    fligsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtg
    wettvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaip
    ansagnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltde
    trcpfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyq
    siigngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfv
    ipkggeyfflpsisaltatiaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3qB (B:)
    tilplnniqgdilvgmkkqkerfvffqvndatsfktalktyvperitsaailisdpsqqp
    lafvnlgfsntglqalgitddlgdaqfpdgqfadaanlgddlsqwvapftgttihgvfli
    gsdqddfldqftddisstfgssitqvqalsgsarpgdqaghehfgfldgisqpsvtgwet
    tvfpgqavvppgiiltgrdgdtgtrpswaldgsfmafrhfqqkvpefnaytlanaipans
    agnltqqegaeflgarmfgrwksgapidlaptaddpalgadpqrnnnfdysdtltdetrc
    pfgahvrktnprqdlggpvdtfhamrssipygpetsdaelasgvtaqdrgllfveyqsii
    gngfrfqqinwannanfpfskpitpgiepiigqttprtvggldplnqnetftvplfvipk
    ggeyfflpsisaltatiaa