PDB entry 2d3l

View 2d3l on RCSB PDB site
Description: Crystal structure of maltohexaose-producing amylase from Bacillus sp.707 complexed with maltopentaose.
Class: hydrolase
Keywords: Protein-carbohydrate complex, ligand binding, Hydrolase
Deposited on 2005-09-29, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucan 1,4-alpha-maltohexaosidase
    Species: Bacillus sp. [TaxId:1416]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2d3la1, d2d3la2
  • Heterogens: GLC, CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d3lA (A:)
    hhngtngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgyga
    ydlydlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvrav
    evnpnnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykf
    rghgkawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkh
    ikysftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlyna
    sksggnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltre
    qgypsvfygdyygipthgvpamrskidpilearqkyaygkqndyldhhniigwtregnta
    hpnsglatimsdgaggskwmfvgrnkagqvwsditgnrtgtvtinadgwgnfsvnggsvs
    iwvnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d3lA (A:)
    tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
    dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
    nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
    kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
    ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
    gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
    svfygdyygipthgvpamrskidpilearqkyaygkqndyldhhniigwtregntahpns
    glatimsdgaggskwmfvgrnkagqvwsditgnrtgtvtinadgwgnfsvnggsvsiwvn
    k