PDB entry 2d30

View 2d30 on RCSB PDB site
Description: Crystal Structure of Cytidine Deaminase Cdd-2 (BA4525) from Bacillus Anthracis at 2.40A Resolution
Class: hydrolase
Keywords: Purines, pyrimidines, nucleosides, nucleotides, salvage of nucleosides and nucleotides, Structural Genomics, Structural Proteomics in Europe, SPINE, HYDROLASE
Deposited on 2005-09-21, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cdd-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d30a1
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Bacillus anthracis [TaxId:1392]
    Gene: cdd-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d30b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d30A (A:)
    gsshhhhhhmnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglc
    ncaertalfkavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgd
    vqettvgellpgaflaedlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d30A (A:)
    mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf
    kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel
    lpga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d30B (B:)
    gsshhhhhhmnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglc
    ncaertalfkavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgd
    vqettvgellpgaflaedlhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d30B (B:)
    mnskqliqeaiearkqayvpyskfqvgaalltqdgkvyrgcnvenasyglcncaertalf
    kavsegdkefvaiaivadtkrpvppcgacrqvmvelckqdtkvylsnlhgdvqettvgel
    lpga