PDB entry 2d2z

View 2d2z on RCSB PDB site
Description: Crystal structure of Soluble Form Of CLIC4
Class: transport protein
Keywords: Soluble Form, CLIC4, TRANSPORT PROTEIN
Deposited on 2005-09-21, released 2006-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride intracellular channel protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2za1, d2d2za2
  • Chain 'B':
    Compound: Chloride intracellular channel protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d2zb1, d2d2zb2
  • Chain 'C':
    Compound: Chloride intracellular channel protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y696 (Start-252)
      • expression tag (253-254)
    Domains in SCOPe 2.07: d2d2zc1, d2d2zc2, d2d2zc3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2zA (A:)
    malsmplnglkeedkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlk
    rkpadlqnlapgthppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmd
    ifakfsayiknsrpeanealergllktlqkldeylnsplpdeidensmedikfstrkfld
    gnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdeftntcpsdkev
    eiaysdvakrltklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2zA (A:)
    eplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrlqnlapgthppfit
    fnsevktdvnkieefleevlcppkylklspkhpesntagmdifakfsayiknsrpeanea
    lergllktlqkldeylnsplpkfstrkfldgnemtladcnllpklhivkvvakkyrnfdi
    pkemtgiwryltnaysrdeftntcpsdkeveiaysdvakrltk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d2zB (B:)
    malsmplnglkeedkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlk
    rkpadlqnlapgthppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmd
    ifakfsayiknsrpeanealergllktlqkldeylnsplpdeidensmedikfstrkfld
    gnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdeftntcpsdkev
    eiaysdvakrltklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2zB (B:)
    plnglkeedkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrkpad
    lqnlapgthppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmdifakf
    sayiknsrpeanealergllktlqkldeylnsplpdeikfstrkfldgnemtladcnllp
    klhivkvvakkyrnfdipkemtgiwryltnaysrdeftntcpsdkeveiaysdvakrltk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d2zC (C:)
    malsmplnglkeedkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlk
    rkpadlqnlapgthppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmd
    ifakfsayiknsrpeanealergllktlqkldeylnsplpdeidensmedikfstrkfld
    gnemtladcnllpklhivkvvakkyrnfdipkemtgiwryltnaysrdeftntcpsdkev
    eiaysdvakrltklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2zC (C:)
    edkeplielfvkagsdgesigncpfsqrlfmilwlkgvvfsvttvdlkrkpadlqnlapg
    thppfitfnsevktdvnkieefleevlcppkylklspkhpesntagmdifakfsayikns
    rpeanealergllktlqkldeylnsplpfstrkfldgnemtladcnllpklhivkvvakk
    yrnfdipkemtgiwryltnaysrdeftntcpsdkeveiaysdvakrltkle